PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P06950_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 181aa    MW: 19986.1 Da    PI: 8.5633
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P06950_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-18127179254
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+
  GSMUA_Achr7P06950_001 127 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRAR 179
                            788899**********************************************9 PP

2HD-ZIP_I/II82.27.9e-27127179153
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRAR 53 
                            +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRAR
  GSMUA_Achr7P06950_001 127 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRAR 179
                            69**************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.3E-311104IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466899.41E-18115179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-18116177IPR009057Homeodomain-like
PROSITE profilePS5007116.86123181IPR001356Homeobox domain
SMARTSM003891.2E-10125181IPR001356Homeobox domain
PfamPF000467.3E-16127179IPR001356Homeobox domain
CDDcd000861.76E-16127179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MMGKDDLGLS LSLSSSSHHH RHLPLQLNLM PSSSASGRPP SPPFPCHQTT QWAVDARSLP  60
LLRGIDVNRA PSSGAVERDS EEDAGASSPN STLSSVSGKR AERDTHLGDE HDPDRGISDE  120
DDGDGSRKKL RLSKDQSAIL EESFKEHNTL NPKQKLALAK QLNLRPRQVE VWFQNRRARR  180
S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125131SRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407821.11e-108PREDICTED: homeobox-leucine zipper protein HAT4-like isoform X2
SwissprotP466012e-56HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLM0TFD51e-129M0TFD5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P06950_0011e-128(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.12e-33Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein